Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2611340.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 810aa    MW: 88258 Da    PI: 6.216
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2611340.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
                      688999***********************************************999 PP

            START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                      ela++a++elvk+a+ +ep+Wv++   e++n de+ +++++  +     + +ea+r++g+v+ ++  lve+l+d++ +W+e+++    + +t+e
                      5899********************999*************9999********************************.***************** PP

            START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwveh 169
                      vis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ ++ ++ +  +++lpSg+++++++ng+skvtwveh
                      ************************************************************99******************************** PP

            START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      ++++++++h+l+r+l++sg+ +ga++wva lqrqce+
                      ***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.443114174IPR001356Homeobox domain
SMARTSM003892.2E-17115178IPR001356Homeobox domain
CDDcd000861.82E-18116174No hitNo description
PfamPF000461.9E-18117172IPR001356Homeobox domain
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084844.647316551IPR002913START domain
SuperFamilySSF559612.06E-32318548No hitNo description
CDDcd088756.33E-121320547No hitNo description
SMARTSM002344.8E-46325548IPR002913START domain
PfamPF018522.8E-56325548IPR002913START domain
SuperFamilySSF559611.88E-22576803No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490275.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
RefseqXP_014490274.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0S3RT530.0A0A0S3RT53_PHAAN; Uncharacterized protein
STRINGGLYMA09G40130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein